PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000142580
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 304aa    MW: 34241.3 Da    PI: 7.391
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000142580genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding24.37.3e-082770445
                     S-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding  4 WTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwq 45
                     WT+eE +l+ +a +++ ++   +W ++a++++ g+t  +++  + 
    MDP0000142580 27 WTAEENKLFENALALYDKDtpeRWLSVAAMIP-GKTVGDVIKQYK 70
                     ********************************.****99988775 PP

2Myb_DNA-binding47.25e-15133177347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ +++ + k++G+g+W+ I+r + ++Rt+ q+ s+ qky
    MDP0000142580 133 PWTEEEHRQFLMGLKKYGKGDWRNISRNFVTTRTPTQVASHAQKY 177
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512939.7862277IPR017884SANT domain
SMARTSM007177.2E-92375IPR001005SANT/Myb domain
SuperFamilySSF466892.08E-102679IPR009057Homeodomain-like
PfamPF002491.5E-62770IPR001005SANT/Myb domain
CDDcd001672.98E-72772No hitNo description
PROSITE profilePS5129420.486126182IPR017930Myb domain
SuperFamilySSF466891.87E-17128181IPR009057Homeodomain-like
TIGRFAMsTIGR015571.2E-17129181IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.605.7E-13130177IPR009057Homeodomain-like
SMARTSM007172.1E-13130180IPR001005SANT/Myb domain
CDDcd001673.40E-11133178No hitNo description
PfamPF002492.0E-12133177IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 304 aa     Download sequence    Send to blast
MFRGMEXFSP NLQNSNWLFQ ESKGADWTAE ENKLFENALA LYDKDTPERW LSVAAMIPGK  60
TVGDVIKQYK ELEEDVSDIE AGLIPIPGYT SNNFTLEWVN DQGFDGLKQF YSVGGKRGAS  120
TRPADQERKK GVPWTEEEHR QFLMGLKKYG KGDWRNISRN FVTTRTPTQV ASHAQKYFIR  180
QLTGGXDKRR SSIHDITTVN LLDVKPSSPD STKSPPSSAH SSTVVQQPHQ HQKLTGTSID  240
WKSADEGQHL VGSANGNNNF MGPFCGMSTH VPKXEEQSFL SGSLHGSQFG HYNARFEMQS  300
MRYQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A2e-1624108891RADIALIS
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.26510.0fruit| leaf
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGQ2461630.0GQ246163.1 Malus x domestica cultivar Jiangsu Fuji MYB transcription factor (MYB53) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008388135.10.0PREDICTED: transcription factor DIVARICATA-like
SwissprotQ8S9H71e-107DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLE7BJY50.0E7BJY5_MALDO; MYB transcription factor (Fragment)
STRINGPOPTR_0016s11980.11e-146(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF46634162
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38090.11e-115MYB family protein